PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi001567
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family G2-like
Protein Properties Length: 441aa    MW: 48785.2 Da    PI: 6.6135
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S50072886PU_refUnigeneView CDS
PUT-183a-Picea_sitchensis-883PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.97e-3181135155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                k+rlrWtp+LHerFv+av+qLGG+++AtPk +l++m+++ Lt+++vkSHLQk+Rl
  Psi001567  81 KQRLRWTPDLHERFVNAVTQLGGADRATPKGVLRMMGIQWLTIYQVKSHLQKFRL 135
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.89578138IPR017930Myb domain
SuperFamilySSF466891.36E-1679135IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-3080136IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-2481136IPR006447Myb domain, plants
PfamPF002492.9E-883133IPR001005SANT/Myb domain
PfamPF143791.6E-21167213IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
XALNQGRKEY SVTKFSALAI IRNPGLPSSE YDLLSTCSLF KMYHGKNIST SHSHEQDISS  60
GALVGANDAL NSLSTSAMAS KQRLRWTPDL HERFVNAVTQ LGGADRATPK GVLRMMGIQW  120
LTIYQVKSHL QKFRLARYIP GSMDDGQNTG RKETTGILSN LDARSGIQIT DALKMQMEVQ  180
TRLHEQLEVQ RQLQQRIEAQ GKYFQKILEE QQRLGGVLKD SANSVDCISI ISGEQSAQDS  240
DVKLDLTAHP TQATSQDVSG AGRACNKLEN LLHDNASDDE SKSFSSQQNP SSNSLSSELS  300
LPLESTNPAE PPLKKLRLEK PSSSELHICN QSDQKHMNRL SLDQTAEVKC DPDVDGQTSV  360
FTRHECQPGH SGSSVEQRQL LFSIQDSHIS LNVQPSNSAT NLSSLPEPQP QLDEELPKFL  420
HLHETPSART SYSLMKRSDI H
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.139210.0shoot
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015901105.16e-75PREDICTED: myb family transcription factor APL
TrEMBLB8LMR60.0B8LMR6_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.19e-57G2-like family protein